Loading...
Statistics

dqkf.top
www.dqkf.top/
Advertisement

Dqkf.top

Dqkf.top is hosted in China / Beijing . Dqkf.top doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_547_1608221.js, Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: Tengine/1.4.2.

Technologies in use by Dqkf.top

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_547_1608221.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

CDN

Number of occurences: 1
  • CloudFront

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Dqkf.top

Missing HTTPS protocol.

    Meta - Dqkf.top

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 124.16.31.156
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • parkmydomain.vhostgo.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Tue, 04 Oct 2016 22:17:30 GMT Content-Type: text/html;charset=utf-8 Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=lpd9rp5hqfq2oeqra3jdlhme87; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_fl282 Transfer-Encoding: chunked Via: 1.1 s_fl282 (squid/3.5.20) Connection: keep-alive

    DNS

    host: parkmydomain.vhostgo.com
    1. class: IN
    2. ttl: 3417
    3. type: A
    4. ip: 124.16.31.156
    host: dqkf.top
    1. class: IN
    2. ttl: 900
    3. type: CNAME
    4. target: parkmydomain.vhostgo.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.qkf.top, www.dtqkf.top, www.tqkf.top, www.dgqkf.top, www.gqkf.top, www.dbqkf.top, www.bqkf.top, www.dxqkf.top, www.xqkf.top, www.dsqkf.top, www.sqkf.top, www.dfqkf.top, www.fqkf.top, www.dvqkf.top, www.vqkf.top, www.dyqkf.top, www.yqkf.top, www.dzqkf.top, www.zqkf.top, www.daqkf.top, www.aqkf.top, www.deqkf.top, www.eqkf.top, www.drqkf.top, www.rqkf.top, www.dkf.top, www.dqekf.top, www.dekf.top, www.dqrkf.top, www.drkf.top, www.dqvkf.top, www.dvkf.top, www.dqbkf.top, www.dbkf.top, www.dqnkf.top, www.dnkf.top, www.dqfkf.top, www.dfkf.top, www.dqgkf.top, www.dgkf.top, www.dqhkf.top, www.dhkf.top, www.dqykf.top, www.dykf.top, www.dqf.top, www.dqktf.top, www.dqtf.top, www.dqkf.top, www.dqf.top, www.dqkgf.top, www.dqgf.top, www.dqkbf.top, www.dqbf.top, www.dqknf.top, www.dqnf.top, www.dqkhf.top, www.dqhf.top, www.dqkyf.top, www.dqyf.top, www.dqklf.top, www.dqlf.top, www.dqkof.top, www.dqof.top, www.dqkuf.top, www.dquf.top, www.dqkif.top, www.dqif.top, www.dqkmf.top, www.dqmf.top, www.dqk.top, www.dqkfq.top, www.dqkq.top, www.dqkf.top, www.dqk.top, www.dqkfa.top, www.dqka.top, www.dqkfy.top, www.dqky.top, www.dqkft.top, www.dqkt.top, www.dqkfg.top, www.dqkg.top, www.dqkfb.top, www.dqkb.top, www.dqkfw.top, www.dqkw.top, www.dqkfs.top, www.dqks.top, www.dqkfd.top, www.dqkd.top, www.dqkfr.top, www.dqkr.top, www.dqkf3.top, www.dqk3.top, www.dqkf4.top, www.dqk4.top,

    Other Reviews

    1. Home
      Scottsdale (United States) - 72.167.191.69
      Server software: DPS/1.0.6
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    2. Botel MATYLDA - Botel Matylda
      Botel MATYLDA
      Prague (Czech Republic) - 94.142.233.164
      Server software: Apache/2.2
      Technology: CSS, Html, Javascript, Php, Swf Object
      Number of Javascript: 3
      Number of meta tags: 3
    3. fukuoka school, special education school
      The mission of our organization is to educate and train the special children in such a way that their dependence on their parents be reduced and they become....
      Houston (United States) - 192.185.122.147
      G Analytics ID: UA-73672830-1
      Server software: nginx/1.10.1
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, Google Analytics, Wordpress
      Number of Javascript: 7
      Number of meta tags: 5
    4. superawesomemegagiganticprettysweetfriendzine.com
      Switzerland - 141.8.224.93
      Server software: Apache
      Technology: Html
    5. Circus in Education | School Workshops & Performances
      Circus in Education delivers physical demonstration and emotional skills into classrooms through school workshops & performances throughout Australia.
      Sydney (Australia) - 52.64.177.7
      Server software: Apache
      Technology: Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Pingback, Shortcodes, Google Analytics, Wordpress
      Number of Javascript: 6
      Number of meta tags: 9
    6. srmg.info
      Lansing (United States) - 69.16.192.64
      Server software: nginx/1.10.1
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of meta tags: 1
    7. ideenfix.de
      Germany - 62.116.130.8
      Server software: Apache
      Technology: Html, Html5
    8. beachbudcaddy.net
      Scottsdale (United States) - 184.168.221.49
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. Tere tulemast ! - Arvutiteenused ja kaugabi.
      Estonia - 212.47.208.172
      Server software: Apache/2
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cookie, jQuery Cycle, Lightbox, Php, Pingback, Swf Object, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 27
      Number of meta tags: 3
    10. .: Green Energy Group :.
      Romania - 86.106.30.142
      Server software: LiteSpeed
      Technology: CSS, Html
      Number of meta tags: 1